Protein Info for mRNA_1962 in Rhodosporidium toruloides IFO0880

Name: 10330
Annotation: K00133 asd aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00978: aspartate-semialdehyde dehydrogenase
  • amino acids 8 to 357 (350 residues), 372.1 bits, E=1.3e-115
• PF01118: Semialdhyde_dh
  • amino acids 9 to 131 (123 residues), 98 bits, E=5.6e-32
• PF02774: Semialdhyde_dhC
  • amino acids 164 to 342 (179 residues), 140.9 bits, E=5.2e-45

Best Hits

Swiss-Prot: 55% identical to DHAS_SCHPO: Probable aspartate-semialdehyde dehydrogenase (SPCC1827.06c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 68% identity to scm:SCHCODRAFT_46400)

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• dipicolinate biosynthesis (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• L-lysine biosynthesis III (3/7 steps found)
• L-lysine biosynthesis VI (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• L-lysine biosynthesis I (3/9 steps found)
• L-lysine biosynthesis II (3/9 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Protein Sequence (363 amino acids)

>mRNA_1962 K00133 asd aspartate-semialdehyde dehydrogenase (Rhodosporidium toruloides IFO0880)
MSQPAREVKVAIAGATGTVGQRFICLLASHPYFRIVSLNASPRSAGKSYREAVKWKQPVP
IPKQVLDMTVKTCEVDQFGDAEIVFSGLDSDVAGDVEEGLRKAEYAVFSNAGNFRRDPLV
PLVVPLVNPSHFGIIPHQKETLGLNKGFIITNANCSTTGIVIPLHALEKAFGPLETVMVT
TMQAISGAGYPGVSSLDILDNVVPYIAKEEEKIEWELGKILGGLSDDLKEFDYHSKHPMK
VSAACNRVPVVDGHLECMSIRFARRPPPSPQQVKDALRAYYSEAQKLGCPSAPEQAVYVH
EEADRPQPRLDRHFQNGAGVNVGRVRECKVLDIRMVVLSHNTNIGAATSSVMNAEYAVAK
GIV