Protein Info for mRNA_1964 in Rhodosporidium toruloides IFO0880

Name: 10332
Annotation: K01495 GCH1, folE GTP cyclohydrolase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00063: GTP cyclohydrolase I
  • amino acids 70 to 247 (178 residues), 262.4 bits, E=8.1e-83
• PF01227: GTP_cyclohydroI
  • amino acids 71 to 246 (176 residues), 244.8 bits, E=2e-77

Best Hits

Swiss-Prot: 63% identical to GCH1_SCHPO: GTP cyclohydrolase 1 (SPAC17A5.13) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 72% identity to mgl:MGL_1201)

MetaCyc: 60% identical to GTP cyclohydrolase subunit (Homo sapiens)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)
• drosopterin and aurodrosopterin biosynthesis (4/7 steps found)
• superpathway of tetrahydrofolate biosynthesis (6/10 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (1/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (1/4 steps found)
• preQ₀ biosynthesis (1/4 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (251 amino acids)

>mRNA_1964 K01495 GCH1, folE GTP cyclohydrolase I (Rhodosporidium toruloides IFO0880)
MLALERQKASGGSSGAGAQAGLGGTFEPFVGSRVGSPIPDKHGLGWPGKGTLARLNATPE
ERTAREQKLADAVKVLLECIGEDPERDGLIKTPERYAKALLWMTKGYEERLPDVIGNAIF
AEDHEEMVIVRDIDIFSLCEHHMVPFSGKVSIGYIPNKFVLGLSKLARIAETFSRRLQVQ
ERLTKQIATAIDEAIRPMGVAVVIEATHQCMTMRGVQKPGATTITSSMLGAFRRSDKTRA
EFMSLIRTPQR