Protein Info for mRNA_1971 in Rhodosporidium toruloides IFO0880

Name: 10339
Annotation: K02429 fucP MFS transporter, FHS family, L-fucose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 372 (341 residues), 74.1 bits, see alignment E=5.1e-25

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 50% identity to fgr:FG03869.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>mRNA_1971 K02429 fucP MFS transporter, FHS family, L-fucose permease (Rhodosporidium toruloides IFO0880)
MAGGAVASNVKAAGPALTRRQEIFSFALVASLFFAWGLSYGLIDVLNKKVVEHFGISKLQ
STLLQVAYFGAYLVYSVPASLFASRFGYRAGILMGLSLYCAGALAFWPSAHFEKYYGFVI
SAFVIACGLATLETMANSFISVLGPPEGAAFRLNLAQSMNGLSAFLGPLIASKTFFSGKN
ANSLDALQWVYLAVACLGAALFVLFFFAKLPNITDADMEDQAESSGIVDERPVWQRKHTM
FGFLTQLFYVGAQVSTASFVLFYLTETDGRTSAEASQMLSYLQITFMVARFASTPLLRFF
NPCLVLAAYGTSCTVFSLMAALTGGKAGLAAFFLVFFSESVIYPTTFTLATSHLGRHTKR
GAGILCMGVAGGSFFPSAQGAFADAKGTRISYIVPMLGFSACAFYGAGMYFYMRRQAKLI
ADNAVLAGPAVPVVADVNALEKEESIEKVEIEDTRLEAVSRV