Protein Info for mRNA_1986 in Rhodosporidium toruloides IFO0880

Name: 10354
Annotation: KOG2458 Endoplasmic reticulum protein EP58, contains filamin rod domain and KDEL motif

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 transmembrane" amino acids 63 to 80 (18 residues), see Phobius details PF05686: Glyco_transf_90" amino acids 572 to 694 (123 residues), 57.2 bits, see alignment E=7.3e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>mRNA_1986 KOG2458 Endoplasmic reticulum protein EP58, contains filamin rod domain and KDEL motif (Rhodosporidium toruloides IFO0880)
MGNGLDDAPLLPHYVEPDTPMIGSTGRHPRTRPGARGGADSPGAGAGGGGGGRLVAFWRQ
RPRLVGSLLFAVLVVLIVLPDDNRSKAHSALTKAGVPLPDELPERLQGFIDYLNFDDGSN
DLKYVPPPPPVETEDFGLPDTGLDTPHKFDPNGQLLVEPLSSFPEPPAPHPILTLIKRAE
IEWNKKVQRQSKTLKDAVHEYRRRYKRNPPRGFEKWWAYAKANRVILVDEYDQIHRDLQP
FWALEPGDLAHRVRVMQERAETFTIKVTDGKTTEEGEQAFLRRAKDLSDLISRFSAHVPD
VNLTFTRHDQPACQLDVFHKERMLELAALGEYWGPSDYLENSDVRLSNWAIGCPPDSALR
MVEQAVLDEIEENGEDSPPTEELVARFKKAYGETQQKPSTSPARSYIYDHSAAMDICQHP
ENMNLHGFTSVAGTDPGPLVPLFTFAKTNVHSDILVTPLEQYSDTYIGYEPDWDKKTKNM
LMWRGSTTGIDFYVQNDWKNSQRARLHFLANDKEGTKSVLWAEGDGAIREKTYNVNGLNR
AYMDVAFAGGPVQCDPETCALMNKLIDFRDTMGLNEAYQYKYVMDVDGNGWSGRFHRLMS
MKACVFKSTLFPEWYADRVQPWLHYVPVKVDYSDLYDIMTFFHGTPEGHGSHDELANKIG
LAGKHWARDHWRKQDMAAYMFRLILEWARLLHRNDEDSHSLDFDFDL