Protein Info for mRNA_2032 in Rhodosporidium toruloides IFO0880

Name: 10400
Annotation: KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details PF03151: TPT" amino acids 9 to 295 (287 residues), 81.6 bits, see alignment E=3.4e-27

Best Hits

KEGG orthology group: None (inferred from 52% identity to cci:CC1G_03552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>mRNA_2032 KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter (Rhodosporidium toruloides IFO0880)
MWKRLPAWVYIIAWIATSSAVILQNAHILSDLKFRHPVALTTIHLAFQTLATRLLRRYTN
MVDKAKELEATGTMNRDSFLRKIVPVGLLFSASLVLSNWVYLRLSVSFIQMIKAFTPVSV
LLVSASFGLKELTRKILLIVSLISFGVALASYGEVEFELIGFLVQALAIGIESCRLVLVQ
KLLQGFGLDPIASLYYLAPVCLAVNAVILLPVEGFEVFSNAVELVGIPYLLMNACLTFAL
NLASVSLIGRASGLVLTLSGVLKDILLIAGSWALMGSTITGIQILGYAIALAGLVWFKQQ