Protein Info for mRNA_2059 in Rhodosporidium toruloides IFO0880

Name: 10427
Annotation: K13509 AGPAT1_2 lysophosphatidate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00530: 1-acylglycerol-3-phosphate O-acyltransferases
  • amino acids 62 to 193 (132 residues), 124.4 bits, E=1.2e-40
• PF01553: Acyltransferase
  • amino acids 65 to 193 (129 residues), 106.1 bits, E=5.7e-35

Best Hits

KEGG orthology group: K13509, lysophosphatidate acyltransferase [EC: 2.3.1.51] (inferred from 49% identity to pcs:Pc13g04040)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (plastidic) (5/6 steps found)
• phosphatidylglycerol biosynthesis II (non-plastidic) (5/6 steps found)
• superpathway of phospholipid biosynthesis I (bacteria) (9/12 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• palmitoleate biosynthesis III (cyanobacteria) (1/2 steps found)
• phospholipid remodeling (phosphatidate, yeast) (1/2 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• palmitoyl ethanolamide biosynthesis (3/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• anandamide biosynthesis II (3/8 steps found)
• diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (15/28 steps found)
• plasmalogen biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.51

Protein Sequence (298 amino acids)

>mRNA_2059 K13509 AGPAT1_2 lysophosphatidate acyltransferase (Rhodosporidium toruloides IFO0880)
MLSRFVAPIRYYLRLTTFLVGLAANAMFGAIMALPMSLVGKGKDNQWLVARSFVNTVAPL
VGVKFRVEGREHLDKANPAVLVGNHQTMVDILYMGAVFPKGTSVMAKRELQWTPILGQWM
TLSKAVFVNRAKREDAVKVFAKVAAKMKKNSLSLWIFAEGTRSASPTPSLLPFKKGAFHL
AVQAGLPVVPIVCENYAHVYHAKAKRFNDGEIVVRVLEPIPTGGYTSSSADIARLTELTR
DRMLEAIEDLGRKRQEQLRLAGGQGHGEGEREALLAGQAGRASTSGETASARIEAPSE