Protein Info for mRNA_2062 in Rhodosporidium toruloides IFO0880

Name: 10430
Annotation: K06210 NMNAT nicotinamide mononucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01467: CTP_transf_like
  • amino acids 28 to 233 (206 residues), 85.6 bits, E=2e-28
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 28 to 258 (231 residues), 150.2 bits, E=3.7e-48

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18), eukaryotic PNAT family @ Nicotinamide-nucleotide adenylyltransferase (EC 2.7.7.1), eukaryotic PNAT family" (EC 2.7.7.1, EC 2.7.7.18)

MetaCyc Pathways

• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD de novo biosynthesis I (from aspartate) (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• NAD biosynthesis III (from nicotinamide) (1/2 steps found)
• NAD salvage pathway IV (from nicotinamide riboside) (1/2 steps found)
• NAD salvage (plants) (6/11 steps found)
• aspartate superpathway (15/25 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.1 or 2.7.7.18

Protein Sequence (352 amino acids)

>mRNA_2062 K06210 NMNAT nicotinamide mononucleotide adenylyltransferase (Rhodosporidium toruloides IFO0880)
MDGPYTFPTHRLARLEGANADKTPLVLVACGSYSPVTFLHLRLFEMARDDAHFNTSFHVV
GGYLSPVNDKYNKLGLASAKHRVAMCDQAVSDTSDWLMVDPWEARQPRYLPTAQVLDHFD
HELNTVRGGADVVVRDPRTGETRVEKRRVRVMLLAGSDLILTMSEPGVWAEKDLHHILGI
YGCYIIERSESELDQSIFSSSSVHSRSPLALYRHNIHMVEQTVRNDVSSTKVRLFIRKGM
SVKYLIPSVVIRYINRHGYRTADRRRSSLAQVAPTASPSLVPTLRESGALADDSAVVFED
DEGDEAEKEREKERRVERERREGASLSPAHADQAQQEQAGGDVEMIASTSAS