Protein Info for mRNA_2087 in Rhodosporidium toruloides IFO0880

Name: 10455
Annotation: K19792 FET4 low-affinity ferrous iron transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 94 to 117 (24 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details amino acids 485 to 498 (14 residues), see Phobius details PF04120: Iron_permease" amino acids 211 to 269 (59 residues), 31.7 bits, see alignment 6e-12 amino acids 325 to 391 (67 residues), 27.6 bits, see alignment E=1.1e-10 amino acids 442 to 514 (73 residues), 62.2 bits, see alignment E=2.3e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>mRNA_2087 K19792 FET4 low-affinity ferrous iron transport protein (Rhodosporidium toruloides IFO0880)
MFRRLITVLASPGSRPALVVSAPSVLPAGAIGADKAVPRDDSSLDLLKSEEKLASWQDNL
ATSPADSSVKVVDGIVAPRSRLDRYLDTIVHWSGSLPFFLFVSSGLIAWAILGVAGYGHD
TNWNVLISDIQAVLTYILDSFLVRQQLAAHDSVLVVTAVLRSRGQSIEAMWRQLASQKDA
VVEGSYTTAGPPREEKVTIDVSLPEDTWVGRCAKRLSDVAGHLVTLVLFWIGIAVWLAFG
PSQEWSNEWQLYMNSSSSALMLFVFAFLCCVRERHGDHVAACLDKIRETDEELERVLRRL
TGDSRPHSTVVVPAPRITRLQRAINYYAEFIGSLVGVASLLVVVVAWAAAGPAFKFDATW
WLLIGTYAGLVGMNDGFVMRHMSAQFQAREGAELARLAETDLACQALVPSTATLDSSSSV
DPPKRSTLSRLLATIDRLTLRASLRVGWLCSHEYAVLLGVLVIAGLVVAASALKWSLTGQ
LLCNVPPSIIESFMMLMVIQGHNENDAKTRSDLSAVFERRAVLLAWARHVERYGVGTSVG
FHPVLVGKYEPVVEAREKADKLDI