Protein Info for mRNA_2097 in Rhodosporidium toruloides IFO0880

Name: 10465
Annotation: K03217 yidC, spoIIIJ, OXA1, ccfA YidC/Oxa1 family membrane protein insertase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 195 to 217 (23 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 197 to 392 (196 residues), 97.5 bits, see alignment E=5.2e-32 PF02096: 60KD_IMP" amino acids 197 to 392 (196 residues), 93.6 bits, see alignment E=6.8e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>mRNA_2097 K03217 yidC, spoIIIJ, OXA1, ccfA YidC/Oxa1 family membrane protein insertase (Rhodosporidium toruloides IFO0880)
MAHCNPARALRVALAAPARHHTPLNTLARQAAQSPALLFASSSTSSLFTRPRSLPSFHRT
FASSAPVRASVFSSLFGAEEKKAEPLPNAADEATAAAVSEEASLAATASPPEPVAASQPA
VDNVPAAVNDFTTLLNPTGPMADPTLTSNYYDGIATGTLDLASLAGSWGIHPIMRLQSMF
LHLHESFPLLGHPGLQWAVLIPVVTLGLRFLLFPFLVRSQRNTAKMAVIQPQLLKGMEKL
KAAKAAGDLQQMQIAQFETQSLMREHGVNPIANFVFPLCQAAIFMCMFFGIRGLANSGLL
SLTTEGFGWVPDLTKSDPYYILPVTSTALTLLTLETGIDGSTTVQTAMTRNMKTIFRALM
VLSLPVIAYFPAALLLYWTTNNFISLIQTSVLKLPAVRTALGIPIPPPKPQPGDKNYVKE
PSFAEAFKTFGTSIKEKVNETAAEAQKATEMQARFKRAQEQRNQAVTPPVAAANGLRKPL
AKPLSNSTQTIAADLAADVVRKAAAPSVPKVPREPLIKAEPVVKAESNAVPSSVRDFERE
KRRRIAASRAARAAKTEQ