Protein Info for mRNA_2101 in Rhodosporidium toruloides IFO0880

Name: 10469
Annotation: K12041 SLC9A6_7, NHE6_7 solute carrier family 9 (sodium/hydrogen exchanger), member 6/7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 151 (27 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details TIGR00840: sodium/hydrogen exchanger 3" amino acids 36 to 465 (430 residues), 416.6 bits, see alignment E=7e-129 PF00999: Na_H_Exchanger" amino acids 44 to 446 (403 residues), 235.6 bits, see alignment E=4.3e-74

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (773 amino acids)

>mRNA_2101 K12041 SLC9A6_7, NHE6_7 solute carrier family 9 (sodium/hydrogen exchanger), member 6/7 (Rhodosporidium toruloides IFO0880)
MNNPNGGIPLPSPTPPASSPLDDIELDPEVQELWSSRALLLVLLLLILSFWVSYYLKVRR
IRSIHETIVAMFSGMCVGALVRLAPGHVVQDMIAFKSTILLNVLLPPIILNSGYQLKQEN
FFRNFAVILSFAFAGTFISAVVLGVIVYLYSLLGLEGLSLTIIECLLFGSTLSATDPVTI
LAIFNALHVDPKLYSVIFGESILNDAVAIVMFETLSQFHGEKIHLLSFFHGTGIFLLTFF
ISMALGVIFGLSCSLMLKHSELGRYTEIEACLVLLIAYTSYFFSNAMSMSGIVSLLFCGI
TLKHYAYHNMSRRTQRATRAIFGILASLAENFIFIYLGLSLFTQTQLVYKPMFILVTGFA
VCVARYCAVFPISKVINVVFRARGARTDELPHSYQMMLFWAGLRGAVGVALAEGMKGEHA
VALRTTVLVAVVMTVVVFGGTIQRMIEILGIRTGVEEEESDSEDEEGVYNLVNSEGADVE
ARRMKRRSLPLGVGGGGGVSATSHHFASQGNGRLSTGDFDQSTSPYRDQQPRRGSAGRLG
AARVPSPRRPQVYVASDNSVSSEDSDPDVLPSPSDPLTAGPSTSSAQLLPGGGLGQVWSA
LDEQYLLPVFSNTTANRHERSKKMAARAKKSSFAVDRAGLEGDEEGGEGMYAGGAGRNKS
FSDIVTALVAPALSSSQGPSTPAPPTPSFASPNSPYPSIDLTAAASSRSLDTRPTPRARS
SGSQPHTPTGSAGSLGGPATPVQPFGGRRGSAMQQGDGYELSGGSGGVADGRR