Protein Info for mRNA_2129 in Rhodosporidium toruloides IFO0880

Name: 10497
Annotation: K17741 GRE2 NADPH-dependent methylglyoxal reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05368: NmrA" amino acids 10 to 133 (124 residues), 31.5 bits, see alignment E=5e-11 PF02719: Polysacc_synt_2" amino acids 10 to 134 (125 residues), 28.9 bits, see alignment E=2.3e-10 PF01370: Epimerase" amino acids 10 to 257 (248 residues), 58.7 bits, see alignment E=2.2e-19 PF01073: 3Beta_HSD" amino acids 12 to 212 (201 residues), 56.2 bits, see alignment E=9.8e-19 PF07993: NAD_binding_4" amino acids 12 to 214 (203 residues), 47.1 bits, see alignment E=6.3e-16 PF13460: NAD_binding_10" amino acids 15 to 151 (137 residues), 45.7 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 47% identity to uma:UM06374.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>mRNA_2129 K17741 GRE2 NADPH-dependent methylglyoxal reductase (Rhodosporidium toruloides IFO0880)
MPAVPASSFVLISGPSGFLGAHVAQQLLQAGFRVRGTVRSKEKGQYLVDRFKQQGLDKFE
FVIVEDVEAPGAFDEAVKGVDAVVHTASPFHFNVTDPYKDLINPAVQGTLNALRSAAKEP
RVKRVVITSSFAAVVNPHDPVYTFTEQDWNEFSPKQVEEKGKDVDPSQAYRCSKTKAEQA
AWKFVEEEKPAFDITTIQPPLIFGPLEHEVPSADKLNTSINNFYGFLTGKKSAEDAQAGF
GSFVDVRDVAKIHVESLLVEEAGNQRFLVATSDSSYQPLLDLFFAHADDSLKSAFPNAEK
GKPGNPKPKANVMDTSKVRKTFKWQPIEAKDTVLDMAKSLAEYQQKWSA