Protein Info for mRNA_2172 in Rhodosporidium toruloides IFO0880

Name: 10540
Annotation: K00968 PCYT1 choline-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 60 to 127 (68 residues), 52.9 bits, E=1.7e-18
• PF01467: CTP_transf_like
  • amino acids 62 to 189 (128 residues), 97.3 bits, E=4.9e-32

Best Hits

KEGG orthology group: K00968, choline-phosphate cytidylyltransferase [EC: 2.7.7.15] (inferred from 55% identity to scm:SCHCODRAFT_70349)

Predicted SEED Role

No annotation

MetaCyc Pathways

• choline biosynthesis III (3/3 steps found)
• phosphatidylcholine biosynthesis I (2/3 steps found)
• cell-surface glycoconjugate-linked phosphocholine biosynthesis (1/3 steps found)
• phosphatidylcholine biosynthesis II (2/5 steps found)
• superpathway of phosphatidylcholine biosynthesis (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (15/28 steps found)
• superpathway of choline biosynthesis (3/12 steps found)
• plasmalogen biosynthesis (4/16 steps found)
• type IV lipoteichoic acid biosynthesis (S. pneumoniae) (1/19 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.15

Protein Sequence (236 amino acids)

>mRNA_2172 K00968 PCYT1 choline-phosphate cytidylyltransferase (Rhodosporidium toruloides IFO0880)
PFPARLHSLLQERPPYPPATTFTPRRLTTPLPQDHIRRAIAGDPGRAYKINPPPTDRPVR
IYADGVYDLLHYGHMLQLRQCKLAFPSVHLLVGVCSSTLVEQHKAKPVLSSQERYESMRH
VRWVDEVVEDAPWQVDQEFIDKWKIDYVAHDEEPYASAGKDDVYAYAKSIGAFLPTKRTN
GISTSELLQRIVEGYREGDYDGKLRKIGHPELCSRQGSEAGTGYGAPHPLPTVGEQ