Protein Info for mRNA_2190 in Rhodosporidium toruloides IFO0880

Name: 10558
Annotation: K00059 fabG 3-oxoacyl-[acyl-carrier protein] reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 27 to 223 (197 residues), 165.5 bits, E=1.6e-52
• PF08659: KR
  • amino acids 29 to 186 (158 residues), 45.3 bits, E=1.4e-15
• PF13561: adh_short_C2
  • amino acids 33 to 238 (206 residues), 154.5 bits, E=5.2e-49

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 56% identity to ncr:NCU07964)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• biotin biosynthesis I (11/15 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (6/9 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• 8-amino-7-oxononanoate biosynthesis I (7/11 steps found)
• oleate biosynthesis IV (anaerobic) (9/14 steps found)
• (5Z)-dodecenoate biosynthesis I (3/6 steps found)
• stearate biosynthesis IV (3/6 steps found)
• cis-vaccenate biosynthesis (2/5 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (9/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (6/12 steps found)
• superpathway of fatty acid biosynthesis II (plant) (28/43 steps found)
• petroselinate biosynthesis (1/6 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (11/20 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (34/53 steps found)
• palmitate biosynthesis III (14/29 steps found)
• tetradecanoate biosynthesis (mitochondria) (11/25 steps found)
• streptorubin B biosynthesis (14/34 steps found)
• anteiso-branched-chain fatty acid biosynthesis (13/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (13/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (13/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Protein Sequence (296 amino acids)

>mRNA_2190 K00059 fabG 3-oxoacyl-[acyl-carrier protein] reductase (Rhodosporidium toruloides IFO0880)
MSTAQDRLSAVSGQLSATHPHGLLAGQVAIVTGAAQGIGKACAVLFAKEGAKVVVADLDE
AKANAVVDEIKKAGGQAIGVGGDVTAPEYPKKLVKATIEAFGDINVLVNMAGFTADRMLH
TTPDDMFELMLKVHNTAPFRLIKEVAPYMRSKDPKDKGKNRSIVNVSSTSGLHGNVGQAN
YATAKAGIIGLTKTVAKEWGPFGVRCNTVAFGYITTRLTQAKELGEAIVVNGKKIPLGIP
SKGSHAQTDDSRVPDIPLGRPGSPEEGAAAVLFLAAGGLSSYISGHTLEVTGGRGI