Protein Info for mRNA_2205 in Rhodosporidium toruloides IFO0880

Name: 10573
Annotation: KOG0381 HMG box-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF09011: HMG_box_2" amino acids 22 to 93 (72 residues), 62 bits, see alignment E=1e-20 PF00505: HMG_box" amino acids 25 to 92 (68 residues), 96.9 bits, see alignment E=1.1e-31 PF08073: CHDNT" amino acids 29 to 65 (37 residues), 21.9 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 47% identical to NHP6_SCHPO: Non-histone chromosomal protein 6 (nhp6) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>mRNA_2205 KOG0381 HMG box-containing protein (Rhodosporidium toruloides IFO0880)
MPKESKPRATKAATGGRAKKDPNAPKRPLSAYMHFSQDQRSVVKEENPDVTFGEIGKILG
AKWKELPEDERKPYEEKASADKSRYEKEKAAYDAENPDAAAAAKPAKKKAPKKAKKVESE
EEDDAADAVDEDDDE