Protein Info for mRNA_2208 in Rhodosporidium toruloides IFO0880

Name: 10576
Annotation: K13621 BTA1 betaine lipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 823 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details PF13489: Methyltransf_23" amino acids 114 to 283 (170 residues), 39.9 bits, see alignment E=1e-13 PF01209: Ubie_methyltran" amino acids 119 to 242 (124 residues), 28.8 bits, see alignment E=2e-10 PF13649: Methyltransf_25" amino acids 128 to 234 (107 residues), 30 bits, see alignment E=1.7e-10 PF08241: Methyltransf_11" amino acids 128 to 237 (110 residues), 28.2 bits, see alignment E=6.1e-10 PF11899: DUF3419" amino acids 438 to 822 (385 residues), 487.6 bits, see alignment E=8.1e-150

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (823 amino acids)

>mRNA_2208 K13621 BTA1 betaine lipid synthase (Rhodosporidium toruloides IFO0880)
MASRMLMLGAAGGLGLYFRPLQAQLTTYTQHAGMSAWLLGAGIAIIALSGFARELVTAWT
FAWNCFFQPLGKNASQEGRLNRFYQGQAAIYDKTRSKLLRGRSTMLKLSAAHLREQRRKN
PNKRLIWLDIGGGTGWNVEEMDKYFPIKDFDAVYVLDLCGPLLEVSRKRFEARGWKNVQC
LLQDATHFVLPEWTEEGLGEEGGLDFVTMSYSLSMMPDHLTLLDRVERFLHPSGLFSVCD
FYVSARETTSVAGVIGDVTSRQCSWLTRWFWLHWFELDHVDLHPSRRQYLEHRFATIKSF
NARNSFVLPGLIRIPYYVSLHTSRRVDTSSANQAYEIDAGNTISASPSPLLMPTLSRQAS
TNEIPDLALGVSAALSRSRSRSSASKPKQRVNRAYSRSSDNSDKSDSVRIDIAPEVQLSA
FHYGYRHWRVPYIDDPVHHEFRTFTYAFAWEDPRVDMEHLKINKDDSVLCITSGGCNALH
YAIDAQPRRIHTVDFNPCQGHVLELKLACIYALEYEDFWLLFGEGRHPNFRELLDSKLSP
FLTSHAYQYWRKNDHMFDSAFYMRGYSGHALRLAYWALRITGMYSSVHKMCAAPTLEEQR
RIWTSRIRPIILSAFIRKVFLANPIFQWNSLGVPINQARVFLKETTTSQFAIDALDPIGL
NSHVAKDNYFYQLCLEAKYTKDSCPLYLTREGFEKLKQNDGAALDCFRLHTDSIMNVMNR
LGKDSLTIAIIMDLQDWFPNTVDSPPAPGSKPCELTQTIRTLRNALKPNGRVFFRSAGQE
PWYLELYRREGFKVECIHKRPIGGKIPIDRVNMYASFYCATKK