Protein Info for mRNA_2212 in Rhodosporidium toruloides IFO0880

Name: 10580
Annotation: K04441 P38 p38 MAP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00069: Pkinase" amino acids 20 to 299 (280 residues), 226.6 bits, see alignment E=3.7e-71 PF07714: Pkinase_Tyr" amino acids 24 to 219 (196 residues), 108.5 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 90% identical to HOG1_USTMA: Mitogen-activated protein kinase HOG1 (HOG1) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K04441, p38 MAP kinase [EC: 2.7.11.24] (inferred from 90% identity to uma:UM02357.1)

MetaCyc: 53% identical to mitogen-activated protein kinase 14 (Homo sapiens)
Mitogen-activated protein kinase. [EC: 2.7.11.24]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.24

Use Curated BLAST to search for 2.7.11.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>mRNA_2212 K04441 P38 p38 MAP kinase (Rhodosporidium toruloides IFO0880)
MAEFVKLSIFGTVFEVTDRYVDLQPVGMGAFGLVCSAKDELTGQMVAIKKIMKPFSTPVL
AKRTYRELKLLKHIQHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARLADPQMTGYVSTRYYR
APEIMLTWQKYDVAVDIWSAGCIFAEMIEGRPLFPGKDHVNQFSIITELLGTPPEDVIQT
ICSENTLRFVQSLPKRERVPFAQKFRGADPQALDLLEKMLVFDPRKRIDAAQALAHEYLA
PYHDPTDEPVAPEPFDWSFNDADLPVDTWKVMMYSEILDFHHIDSEETSGPVAAPTA