Protein Info for mRNA_2246 in Rhodosporidium toruloides IFO0880

Name: 10614
Annotation: K00026 MDH2 malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01772: malate dehydrogenase, NAD-dependent
  • amino acids 15 to 334 (320 residues), 384.3 bits, E=2.3e-119
• PF00056: Ldh_1_N
  • amino acids 16 to 151 (136 residues), 138.8 bits, E=1.4e-44
• PF02866: Ldh_1_C
  • amino acids 153 to 332 (180 residues), 140.9 bits, E=4e-45

Best Hits

KEGG orthology group: K00026, malate dehydrogenase [EC: 1.1.1.37] (inferred from 64% identity to cnb:CNBG1650)

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• mixed acid fermentation (9/16 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• methylaspartate cycle (9/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37

Protein Sequence (338 amino acids)

>mRNA_2246 K00026 MDH2 malate dehydrogenase (Rhodosporidium toruloides IFO0880)
MCGAGWTRGRPAAWVGIGQPLSLLVKQNPAIKELRLFDVVPVVKGVAADVSHVDTPAITT
GYVKDEDGLKHALKGADIVIIPAGVPRKPGMTRDDLFNINAGIVRDLAQGIAENCPKAFV
LIISNPVNSTVPIAAEVFKAAGTFDPKRLFGVTTLDVVRASTMSAQAIGKPNDASQYTIP
VVGGHSGVTILPLLSQSKPALPESLFSDSEKLKALVNRIQFGGDEVVQAKAGGGSATLSM
AYAGYKFAEQLIAAAFEGKKGVVAPSYVYVADNKDVQKEIGQDLAFFSVPVELGPNGAEK
LHPLGQLSSYEKELLQACLGELPGSITKGVNFIQQPKL