Protein Info for mRNA_2257 in Rhodosporidium toruloides IFO0880

Name: 10625
Annotation: K12626 LSM7 U6 snRNA-associated Sm-like protein LSm7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF01423: LSM" amino acids 40 to 113 (74 residues), 71.4 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: K12626, U6 snRNA-associated Sm-like protein LSm7 (inferred from 63% identity to scm:SCHCODRAFT_258381)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>mRNA_2257 K12626 LSM7 U6 snRNA-associated Sm-like protein LSm7 (Rhodosporidium toruloides IFO0880)
MNSDARGRGRGRGSRGGAGRGGSAGRGGGDDRPRREAILDLAKYVDKQIRVKFTGGREVT
GTLKGFDQLLNLVMDDLEETVNDPATGLPLVPQQTRALGLAVLRGTSLVVISPLDGSEEI
ANPFQAA