Protein Info for mRNA_2260 in Rhodosporidium toruloides IFO0880

Name: 10628
Annotation: K03027 RPC40, POLR1C DNA-directed RNA polymerases I and III subunit RPAC1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01193: RNA_pol_L
  • amino acids 42 to 308 (267 residues), 69.7 bits, E=1.2e-23
• PF01000: RNA_pol_A_bac
  • amino acids 72 to 206 (135 residues), 73.4 bits, E=2e-24

Best Hits

Swiss-Prot: 51% identical to RPAC1_YEAST: DNA-directed RNA polymerases I and III subunit RPAC1 (RPC40) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K03027, DNA-directed RNA polymerases I and III subunit RPAC1 (inferred from 56% identity to cnb:CNBD3310)

Predicted SEED Role

"DNA-directed RNA polymerases I and III 40 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase I or RNA polymerase III (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (319 amino acids)

>mRNA_2260 K03027 RPC40, POLR1C DNA-directed RNA polymerases I and III subunit RPAC1 (Rhodosporidium toruloides IFO0880)
LLQVSATDFPGHHPGESHHWDLDHFRSNLRVQVNSLSPTALEFDLVGVDASVANAIRRIV
IAEVPTVAVENVYVWNNTSIIQDEVLAQRLGLIPLAIDPRKLDMKKTPDEPPTDLNTVVF
SLIARCERRKDVKKGETDPHKIWSGVEVLSSNLSFSSRGGQDELFGDRPPKPAIDDILVA
KMRGGQEIVAELHCVKGIGKDHAKWSPVATASYRLLPTIDILADIPPELHSKFEACFPPG
VIEQRSGRLVVANARRDTVSREVLRHPEFEDKVKLGRVRDHFIFSVESAGQYRPEELVPE
AIEVLLAKIRAVRIALNAH