Protein Info for mRNA_2262 in Rhodosporidium toruloides IFO0880
Name: 10630
Annotation: KOG0899 Mitochondrial/chloroplast ribosomal protein S19
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to RT19_YEAST: 37S ribosomal protein S19, mitochondrial (RSM19) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
KEGG orthology group: None (inferred from 59% identity to uma:UM02386.1)Predicted SEED Role
"SSU ribosomal protein S19p (S15e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (92 amino acids)
>mRNA_2262 KOG0899 Mitochondrial/chloroplast ribosomal protein S19 (Rhodosporidium toruloides IFO0880) MWRSPVLLSRSKWKVPYFVPFPGLAEAIKSNSPIRTTARNCTIMPFHVGATFLVHNGKDY IPLHVTPAHVGHKLGEFAHTKKPARHTPRKGR