Protein Info for mRNA_2265 in Rhodosporidium toruloides IFO0880

Name: 10633
Annotation: K08869 ADCK, ABC1 aarF domain-containing kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03109: ABC1
  • amino acids 98 to 225 (128 residues), 88.5 bits, E=1.9e-29

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

• ubiquinol-8 biosynthesis (early decarboxylation) (3/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (5/12 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

Protein Sequence (440 amino acids)

>mRNA_2265 K08869 ADCK, ABC1 aarF domain-containing kinase (Rhodosporidium toruloides IFO0880)
MEASLAATLGVGMASEAFRRSSSPSGGSSQSLLMSEANLERLVAKLSKMRGAALKLGQFL
SIQDTKQLPPQLEAILQRVQNSANFMPEWQTAQVLADNLGDDWQTHFEAFDMRPFAAASI
GQVHRAKLAKVSPLRDRYNGLEELAVKVQFPGVRQSITSDLGTLRWLLVASAALPRGLYL
DNTLRVLGRELEDECDYLREAQCGRKMRDKIASSALADSFDVPEVVDELCGPMVLTTRMM
TGRPLKDVFALDQATRDEIGTRVMQLCMYELFDFRLMQTDPNWSNFLYNPRTRKLELVDF
GATREYSADFMRVYGDLLDAAIAENKDEAIQLSQELGYLTGEEGTAMVDAHLESLFSLAT
PFRDSAPSPFPFGRLGPPITARIRQQIPIMLKHRLKPPPEETYSLNRKLSGAFLLCERLD
SHVPVGKLYRECRRFARCAL