Protein Info for mRNA_2270 in Rhodosporidium toruloides IFO0880

Name: 10638
Annotation: K19833 CLA4 serine/threonine-protein kinase CLA4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 PF00169: PH" amino acids 65 to 154 (90 residues), 42.2 bits, see alignment E=2.5e-14 PF00786: PBD" amino acids 162 to 218 (57 residues), 80.8 bits, see alignment 1.9e-26 PF00069: Pkinase" amino acids 481 to 733 (253 residues), 240.5 bits, see alignment E=5.3e-75 PF07714: Pkinase_Tyr" amino acids 484 to 729 (246 residues), 172.4 bits, see alignment E=3e-54 PF17667: Pkinase_fungal" amino acids 585 to 653 (69 residues), 24.7 bits, see alignment E=2.5e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (753 amino acids)

>mRNA_2270 K19833 CLA4 serine/threonine-protein kinase CLA4 (Rhodosporidium toruloides IFO0880)
MARNGSFLHTRPAPPVPPSASRAPAGYAPFAASQAAKSSASSTANRPIHDASPVASSSGA
AQTILRRGWVSVKEDGLRAWLWSKKWLVLREQSLSFYKNESGGNASTVVQLAEVSAVSRE
DLKPFCISVTTPARTFYLALRSDEELYAWMDDIYERSPLMGVSSPTNFVHQVHVGFDPVS
GAFTGLPEQWTRLLTSSAITKEDYAKNPQAVLDVLEFYTDIQKRERDEFGLGTTSMGMTD
VGRALRADQGGRAAAPSGSRFEAGTGLAGSSSPQPRMPSPANHAISSPATPTTAPRPFPN
PAHGLPSFASTSPSTPSSHSPASPAVTAPKPASASTSDRPALMPGRPAPPAPPGTAPSRP
PPPNNGLRPLLTTASSRSNLHEPSPANLRPAPPPPASAPLPVGAKPLRLLAGTNASAAST
AGPASATTRLGGDGPQEPKTGGPSKKVDKAAGDRRISTLSESQIMAKLRSVCSPADPNAL
YAKIKKVGQGASGSVFVAKVLADGARVAIKQMDLSHQPRKELIVNEILVMKESQHPNIVN
FLDSFLVGGSELWVVMEYMEGGALTDIIDSNTLQEDQIACISNETCKGLRHLHAQSIIHR
DIKSDNVLLDARGHVKITDFGFCAKLTDQKSKRATMVGTPYWMAPEVVKQKEYGAKVDIW
SLGIMAIEMIENEPPYLDEEPLKALYLIATNGTPTLKKPEKLSKELKNFLAVCLCVDVKS
RATADELLEHEFLKKACPPAALAPLLRFRSTAR