Protein Info for mRNA_2301 in Rhodosporidium toruloides IFO0880

Name: 10669
Annotation: HMMPfam-Transmembrane amino acid transporter protein-PF01490

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 110 (30 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details PF01490: Aa_trans" amino acids 55 to 443 (389 residues), 108.8 bits, see alignment E=1.4e-35

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>mRNA_2301 HMMPfam-Transmembrane amino acid transporter protein-PF01490 (Rhodosporidium toruloides IFO0880)
MSGALYDHKPEAYNEKGQMEKEQSARENPEDGHLRPVIADAFALREGEEGEDFKTLGWFK
AGLVITCEAIALGTLSFPKNFYALGLVGGLIANAGFVVIAFFTSCVMVDFKLRYTHVLNA
ADAGQVMFGRIGFWVLGIAMIAKSIGLAASHVLAGKIAIATFDGGANCSIIWAVVIAVVS
AGLSYHRKWSGLTWLSWISLTCIVTACIITMAGVATQNPERLIKKNVPIEWHAFNRDAKL
VDSIGAVLNSAFSYGQTMAVLTFLPEMRRPETFKRSMLLSQIISLVLYSIVGSVCYVYAG
QYVTSPALTMTTHTLRIVSYAFALVTIVVSGIVACNVGAKFWYTTSLRNSALLTSKGGQL
VWLAIIGAMWTIGFVLAELIPFFGDLLTIVSALTSSWFVVGLGGVLWLHLYKKKGNPDGG
YFKTPSRTFFFFFSVLLILISCALTPLGLYAAIEGIKSGYAHGKFHHPFSCAA