Protein Info for mRNA_2312 in Rhodosporidium toruloides IFO0880

Name: 10680
Annotation: K00275 pdxH, PNPO pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01243: Putative_PNPOx
  • amino acids 52 to 138 (87 residues), 41.9 bits, E=9.5e-15
• PF10590: PNP_phzG_C
  • amino acids 220 to 264 (45 residues), 72.1 bits, 3.2e-24

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (3/7 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/10 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (264 amino acids)

>mRNA_2312 K00275 pdxH, PNPO pyridoxamine 5'-phosphate oxidase (Rhodosporidium toruloides IFO0880)
MTSSNPQTLASVSTHETYLSQGIPSASTLDPNPIVQFSKWFSHAQSRPADVPEPEAMSIS
TVDSETHIPSTRVVLLKQVDNRGFIFYTNYSSRKGRELFPDGDYESDSPRGGYVSLAFYW
RALHLSVRVVGKAEKVDRATTQAYYDSRPVGSRIGAWASEQSTVLKSGTREELEERVHEF
ERRFGVPEGTATGSAVTAGPASSAPANPVENVNIPVPPFWGGVRIVPFEVEFWAGRESRL
HDRYRYTRQEGDEKSEWKIERLSP