Protein Info for mRNA_2425 in Rhodosporidium toruloides IFO0880

Name: 10793
Annotation: K02732 PSMB1 20S proteasome subunit beta 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 38% identical to PSB1_PETHY: Proteasome subunit beta type-1 (PBF1) from Petunia hybrida

KEGG orthology group: K02732, 20S proteasome subunit beta 6 [EC: 3.4.25.1] (inferred from 62% identity to cci:CC1G_02904)

Predicted SEED Role

"proteasome subunit beta6 (EC 3.4.25.1)" in subsystem Proteasome eukaryotic (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>mRNA_2425 K02732 PSMB1 20S proteasome subunit beta 6 (Rhodosporidium toruloides IFO0880)
MGPIQHQFNPYADNGGSILAISSSKFAVIAGDTRQSSGYNIETRTAKRVFQLTPEAAIAV
QGFMGDAMNLVKRLKQRLEWYHHTHNEVPSLKSIARLVQTMLYGKRFFPYYSYVILAGID
RDGTGAVYSFDPVGSYERESCRAYGSAQSLVQPFLDNMVYKKNQVPDPSLPPPVPGQRPE
FDLAEVQSLLTDAFTGAAERHIEVGDGLDVLVVEKDMEMRWVHLPLKRD