Protein Info for mRNA_2477 in Rhodosporidium toruloides IFO0880

Name: 10845
Annotation: K00560 thyA, TYMS thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 61% identical to TYSY_PNECA: Thymidylate synthase (THYA) from Pneumocystis carinii

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 66% identity to nfi:NFIA_029120)

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
folate transformations III (E. coli) (7/9 steps found)
folate transformations II (plants) (8/11 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
pyrimidine deoxyribonucleosides salvage (2/5 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.45

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>mRNA_2477 K00560 thyA, TYMS thymidylate synthase (Rhodosporidium toruloides IFO0880)
MTVAPTTTNREELQYLDLVREVINRGERRADRTGTGTLSLFAPPQLRFSLSKPSADPSST
DPNLVLPLLTTKRVFSRGIIEELLWFVEGCTDSKVLAEKGVKIWDGNGSREFLDSRGLQH
REVGDLGPVYGFQWRHFGAEYRTAKDNYEGEGVDQLAEVIDKIKNNPTDRRIILSAWNPA
DLPKMALPPCHMFCQFYVNLPPPNSPPSAKPRLSCLMYQRSADLGLGVPFNIASYALLTH
MIALVSDTIPHEFILQLGDAHVYLDHVEPLKTQLERTPFEFPEFAWKRSREEVGKIDGFR
SDDFIISPKYKENSHPSIPMKMSV