Protein Info for mRNA_2482 in Rhodosporidium toruloides IFO0880

Name: 10850
Annotation: KOG0712 Molecular chaperone (DnaJ superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00226: DnaJ" amino acids 7 to 71 (65 residues), 87.4 bits, see alignment E=8.4e-29 PF01556: DnaJ_C" amino acids 130 to 364 (235 residues), 91 bits, see alignment E=1.3e-29 PF00684: DnaJ_CXXCXGXG" amino acids 156 to 221 (66 residues), 47.1 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: K09503, DnaJ homolog subfamily A member 2 (inferred from 44% identity to cnb:CNBA0480)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>mRNA_2482 KOG0712 Molecular chaperone (DnaJ superfamily) (Rhodosporidium toruloides IFO0880)
MVADTRLYDVLGVAPDASDAEIKKAYRTLALQHHPDKQSSSDGAPADSSRFQEIQHAWET
LSDPEKREDYDNFGEKGPGGRGGPGGFDGADMFDDFFAEMFGGMGGPPPGMGGGGGRPRQ
RRKTQTEPSEVELPVTLEELYNGANKTLSVERTRKCGPCSGSGAKPGRQAKPCMKCNGQG
QTFAMRQMGPYIQRVPVRCSLCDGRGTKVRDQDACKKCKGTRTVKEKKRVEFYLERGMHF
GETIVLKGEGDESPDSCSPGDLHIIVRPLPHPTFSIVPPPHHRSDRPADLSTTLSLTLSE
SLLGFSRLILIHLDGRGLRVNQPAPGQRGWRVLKTGDEVVVPGEGMWRKGEKGDLVLKIE
VAMPDEQWAMGLAEKGGVDTLRGLLPPRRPDLVNIVEDGKDVDDVTLEEKKDSADDEEQW
YHGNGRPYDEDEEGPGCQQQ