Protein Info for mRNA_2518 in Rhodosporidium toruloides IFO0880

Name: 10886
Annotation: K03189 ureG urease accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 75 to 263 (189 residues), 249.7 bits, E=1.1e-78
• PF02492: cobW
  • amino acids 76 to 244 (169 residues), 98.1 bits, E=4.7e-32

Best Hits

Swiss-Prot: 60% identical to UREG_SCHPO: Uncharacterized urease accessory protein ureG-like (SPCPB16A4.05c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K03189, urease accessory protein (inferred from 72% identity to lbc:LACBIDRAFT_245416)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (3/7 steps found)

Protein Sequence (276 amino acids)

>mRNA_2518 K03189 ureG urease accessory protein (Rhodosporidium toruloides IFO0880)
MAPTAQFIPAPALPGSKPSFSSSASPASHSHSHGSHSHGAEEHGHTHEALDHPGKFTERD
MPDFSKRNWEERAFTIGIGGPVGTGKTALTLALCRYFRDNYNIGITTNDIFTVEDCEFLI
KNEALADPGRIRAIQTGGCPHAAIREDISANLGALEDLQATYGCDFLIVESGGDNLAANY
SRELADFIIYVIDVSGGDKIPRKGGPGISQSDLLVINKTDIAQYVGASLEVMKRDSDKMR
DNGPTIFASVKQGEGVEGVAEMILAAWSAATGKSKK