Protein Info for mRNA_2566 in Rhodosporidium toruloides IFO0880

Name: 10934
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 244 to 258 (15 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 406 (388 residues), 142.3 bits, see alignment E=2e-45 PF00083: Sugar_tr" amino acids 42 to 196 (155 residues), 39.7 bits, see alignment E=3.1e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>mRNA_2566 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MYARFSPRRKRAIVGIVAYAALLAPFSSSSFLPSIPQITEDLHTSAFVINVTVAIFILCI
GIFPLVWAPYSGIYGRKPIYVISLPIFALGCLGTALSKSLSALIVTRIIQALGSSPVLSV
GAGTIGDLYPKHERGTAMGLFYLGILVGPATAPAIAGILTEYVKPYGFGWRAMQYLLMSL
GFSAFALVLICFPETAHAKGIDVVRQERLQERAEKEGVEVEGLEKEEQRKRAEMRWARRQ
WEGIAWVWLNPLAPLRLLLHPNIAAMSLNSSFTLMSTYTILVPLSQTLAPRYNITNAAIL
GCFYLAQGVGNATASRYTGRYADWTLKRWLKRRGGVYVPEDRLYAALIGGGVILPCSVLA
LGWVLDKGTGKVGLAFAVILLFIDGIGLMCVLTPSNTYCVDVMPLRSSEVIAVNKRVLSR
LQTACRYIVAAAASAFVLPMINAIGVGWTNTFAAFVVWLGCGMVLLTIRFGPQMRAIGTK
LEGTVSAGTDLEESQEKAGVEVQGSAESGVSTVVQQEATGREEEQPKEKPPEAGLRS