Protein Info for mRNA_2649 in Rhodosporidium toruloides IFO0880

Name: 11017
Annotation: K08157 TPO1 MFS transporter, DHA1 family, multidrug resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 75 to 93 (19 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 307 to 336 (30 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 418 to 443 (26 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details amino acids 479 to 504 (26 residues), see Phobius details PF07690: MFS_1" amino acids 85 to 461 (377 residues), 139.3 bits, see alignment E=7.7e-45

Best Hits

KEGG orthology group: None (inferred from 52% identity to scm:SCHCODRAFT_61786)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>mRNA_2649 K08157 TPO1 MFS transporter, DHA1 family, multidrug resistance protein (Rhodosporidium toruloides IFO0880)
MSRARECLHLLRKRSAVLTTCVDPGSRGTSTGETTQDGSDGDEQQPDEQEKDPNKVEWEE
NDEHNPQNWSDKKKWLITILCAQATLVVTFASSSPSSATQQIAQQFGSSLEVADLTTSLF
LAGYCLGPIVWAPMSEMIGRRPVFVVSLAIFGLFQIGDALAQNIWTIIIIRFLAACFASS
PLTNAGGVIADIWDPMGRGKAMALFSASVFVGPVLGPIIGGFTVMNQSLRWRWIFAFIGF
WSAASWILIAVFLPETYHPKLLAQRAKRLRKEDPDKHGEKYAELEKADFSIRSIVTRTLA
RPAIMLVVEPIVLTVTIYLSVVYGLLYGLFSVFPIIWGELRGFNPGETGLVFIAVGLGTT
IGALIFVWTQRHYRELIPKWHGHPPPEERLYGAMLAGPFLIVGIFWLGWTGNYPSIHWAV
PAASAILIGMSFTLVFISFLTYLVEVYLMYSASSLAANTIIRSATAVAFPLFVRQMFAAL
GVGWACSLFGFVALAISPSPFLFYKYGWKLRQRSRFAPCLDVGLREQVKREEQERKEKEK
NGGTEGV