Protein Info for mRNA_2657 in Rhodosporidium toruloides IFO0880

Name: 11025
Annotation: K02155 ATPeV0C, ATP6L V-type H+-transporting ATPase 16kDa proteolipid subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details TIGR01100: V-type ATPase, C subunit" amino acids 12 to 118 (107 residues), 150.4 bits, see alignment E=9.3e-49 PF00137: ATP-synt_C" amino acids 17 to 75 (59 residues), 50.6 bits, see alignment E=9.8e-18 amino acids 94 to 153 (60 residues), 66.8 bits, see alignment E=9e-23

Best Hits

Swiss-Prot: 66% identical to VATL2_SCHPO: V-type proton ATPase 16 kDa proteolipid subunit 2 (vma11) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02155, V-type H+-transporting ATPase 16kDa proteolipid subunit [EC: 3.6.3.14] (inferred from 75% identity to cne:CNA02690)

MetaCyc: 65% identical to H+-translocating V-ATPase subunit c (Homo sapiens)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>mRNA_2657 K02155 ATPeV0C, ATP6L V-type H+-transporting ATPase 16kDa proteolipid subunit (Rhodosporidium toruloides IFO0880)
MTTELCPPYAPFFGFAGVGASMIFSTIGAAYGTAKAGIGITGMGTLRPELIMKSLIPVVM
AGIIAVYGLVVSVLIVGSLNPSDPYPLYAGFIHLAAGLSCGLTGLAAGRAIGVVGDACAR
AYLRQGRVFVAMVLMLIFAEVIGLYGLIVALILQSKASEGSC