Protein Info for mRNA_2658 in Rhodosporidium toruloides IFO0880

Name: 11026
Annotation: BLAST transmembrane amino acid transporter protein [Rhizoct...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 transmembrane" amino acids 186 to 206 (21 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 265 to 294 (30 residues), see Phobius details amino acids 306 to 337 (32 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 459 to 482 (24 residues), see Phobius details amino acids 524 to 551 (28 residues), see Phobius details amino acids 571 to 589 (19 residues), see Phobius details amino acids 623 to 643 (21 residues), see Phobius details amino acids 666 to 690 (25 residues), see Phobius details amino acids 735 to 758 (24 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (763 amino acids)

>mRNA_2658 BLAST transmembrane amino acid transporter protein [Rhizoct... (Rhodosporidium toruloides IFO0880)
MSRTSPEPHSVDSPAEQEDGREGRETDPLIQETPTAVLGAAGRAVDEDEDDEEGLPESII
RPPRPDLATGESTLTLTRHSSSSHSSLSLTSDLSDADADPSSSTPHALTDSEWKALRKQR
RKLARRMYGGGNGTGRHAHSLSEGFEVEFEEFADEEGGSGECRAAPEEEEDGAGGGGKAD
KSVGEVAGMVCASASLSPFPLLLPLACSTLSPALFVPLLFFAAVLGWMGAVVIGVEGRYV
GARSYPALTSSLLPHRLRLHRLFELFSSLFVLLGSIVRTTLGTVIAAEVAVGVLDVRRSE
GEEGRGWRVAGVAVVCAVWFLVPLVLPPLLSVLGLAATFPSFTSSSSRAPNHSRRPSYSH
YTRLSTVSTPDLRLTTSGESDMPGAGSSGPSERPRWTALLTLPPWSIALLTWPIALLILG
VRIKHINKNVPQPSANSSALLSIPSLPLFSGRLDDEDAALWPSILLTFASGLSTSHETFF
YLTSLRRPSNTAMRHQRRASQAGNIFGAGGGAGAGEGKRNQYPLAIALGLAGAAVLNLGW
SLVGSLGFRFAADFLPAANLLSDTRLPRSDASLWFARILVLFSLLSQLEPHAHVGTLRVR
RAISYCVPTGGAAGEVSEWRRVIARAVVWGLTALAGAGVVYVPRTWVDRGAEGGGGVGEG
EGAAWLAQWSAVIVGGIGGCLLPAIGYLILFHLRRPRLILLTPHLSSQPAHPHEPDSLLQ
RKEREMQRRLSGRRVWSDVAVFGVMGPVGIVLIGRGVVALVRG