Protein Info for mRNA_2665 in Rhodosporidium toruloides IFO0880

Name: 11033
Annotation: HMMPfam-Protein of unknown function (DUF3431)-PF11913

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 143 to 171 (29 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details PF11913: DUF3431" amino acids 430 to 607 (178 residues), 29.4 bits, see alignment E=3.4e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>mRNA_2665 HMMPfam-Protein of unknown function (DUF3431)-PF11913 (Rhodosporidium toruloides IFO0880)
MQSTKFLHQLHPLQPFLPLAFAVSLTAAIYFLSHIAYEPTQRILLLASLPYVVAGLARIG
WLAATRGDRGGILAEIPSERSRRYWAIAALEVAKMVLKVFAARRNELWLWTSVEVFVPAF
SAIVAYLRPLQAPEKPLDRQRQLITLALLALLAVLPFAARLVDGVGLFLAILSAAADGAA
QQLAREHVAKLEDEIDAQSTAELVGETGLRSLAIFVVTYLALFPLGLHDSAVPYGIYRRP
TYEHLFPFFALLAHVFLLLSTSQSSAPSSTLMTSVYAGATASVIALSVLTGSKTAESPYF
LTALLVGLVALTFLAYQPSRLALEPEDDDQPSSSSSAFTHPLLRLAPLFPYALFIFSQLI
NPSTFDIVVAHYDKPLPFFSDHLERVYTAPLIRQSRRRTIVYHKGNLTEDALWSGLGGVL
REGTDEIYLLPNYGREGGTYLEHLIARYDPTSPSSLNPYARPLAHHTLFLQPHMAWDWIA
GSRLLYTLNPRTGFVSLSKYLTNLCGKDSEQGAVYGGLKKVFEEVKGRECREDNEEDRVL
QTWSGQFVVSRERVRRNERGVYERLKDVIEAPDDDPIHDTWSPSGPSTRFNPAFGHALER
SWPLLLHCPDTRIAMECADDGWRAGGCQCWD