Protein Info for mRNA_2696 in Rhodosporidium toruloides IFO0880

Name: 11064
Annotation: K02147 ATPeV1B, ATP6B V-type H+-transporting ATPase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 TIGR01040: V-type ATPase, B subunit" amino acids 33 to 505 (473 residues), 927.7 bits, see alignment E=5.4e-284 PF02874: ATP-synt_ab_N" amino acids 36 to 102 (67 residues), 49.1 bits, see alignment E=6.8e-17 PF00006: ATP-synt_ab" amino acids 159 to 396 (238 residues), 223.2 bits, see alignment E=3.1e-70

Best Hits

Swiss-Prot: 80% identical to VATB_NEUCR: V-type proton ATPase subunit B (vma-2) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02147, V-type H+-transporting ATPase subunit B [EC: 3.6.3.14] (inferred from 84% identity to cci:CC1G_12318)

Predicted SEED Role

"V-type ATP synthase subunit B (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>mRNA_2696 K02147 ATPeV1B, ATP6B V-type H+-transporting ATPase subunit B (Rhodosporidium toruloides IFO0880)
MAPHDPRMSNKEAYAINAAAAVRRYDVNPRLDYRTVSAVNGPLVVLDNVKFPAYNEIVAL
TLPDGTVRGGQVLEVTGRKAIVQVFEGTSGIDVNATHVEFTGSSMKLPVSEDMLGRIFNG
SGQPIDKGPKVFAEDYLDINGSPINPYSRIYPEEMIQTGISTIDVMNSIARGQKIPIFSA
SGLPHNQIAAQICRQAGLVNKESTDRNPEGAPTKGVHDGHEDNFSIVFAAMGVNMETARF
FRQDFEENGSLDRVSLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDMSSY
ADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDDITH
PIPDLTGYITEGQIFVDRQLYNKQIYPPINVLPSLSRLMKSAIGEKLTRKDHGDVSNQLY
SLYAIGKDAAAMKAVVGEEALSSEEKLAIEFLGRFENEFVKQGVNENRSIFDSLDLAWSL
LRLFPREQLNRIPKKVLDEFYSRKASVGSQIKPSSTD