Protein Info for mRNA_2726 in Rhodosporidium toruloides IFO0880

Name: 11094
Annotation: K01725 cynS cyanate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00673: cyanase
  • amino acids 9 to 154 (146 residues), 162.5 bits, E=3.5e-52
• PF02560: Cyanate_lyase
  • amino acids 89 to 155 (67 residues), 112.5 bits, E=3.3e-37

Best Hits

Swiss-Prot: 50% identical to CYNS_COPC7: Cyanate hydratase (CYN1) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 51% identity to scm:SCHCODRAFT_85234)

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• L-citrulline degradation (2/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (2/4 steps found)
• urea degradation I (1/3 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• cyanuric acid degradation II (2/5 steps found)
• uracil degradation III (2/5 steps found)
• cyanuric acid degradation I (1/5 steps found)
• allantoin degradation IV (anaerobic) (2/8 steps found)
• superpathway of atrazine degradation (2/8 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Protein Sequence (158 amino acids)

>mRNA_2726 K01725 cynS cyanate lyase (Rhodosporidium toruloides IFO0880)
MTSVVQSLADVNQQLFEAKKTKKLSFEQIAQRMGRDEVWVAALFYGQAKPTDDEVDKLID
VLGPWVDAKAMKRHFNPHFFPERGQLTPMPPTDPTLYRLYEVVGVYGYALKSVIHEKFGD
GIMSAINFSAKVDKVQKNGADTVRITYEGKWLPYDFHC