Protein Info for mRNA_2729 in Rhodosporidium toruloides IFO0880

Name: 11097
Annotation: KOG1485 Mitochondrial Fe2+ transporter MMT1 and related transporters (cation diffusion facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 32 to 59 (28 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 43 to 315 (273 residues), 95.8 bits, see alignment E=1.4e-31 PF01545: Cation_efflux" amino acids 44 to 227 (184 residues), 68.6 bits, see alignment E=6.6e-23 PF16916: ZT_dimer" amino acids 253 to 313 (61 residues), 34.8 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 55% identity to lbc:LACBIDRAFT_242531)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>mRNA_2729 KOG1485 Mitochondrial Fe2+ transporter MMT1 and related transporters (cation diffusion facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MSARQRRRRTTTACPWVLQYSSTRRRGLTVLLPVAQIKIAVYGSLIANCILAILQLYAAI
SSLSLSIFGTAIDSVFDPLANGVLYYCHRKARRVDLRKYPSGGSKFETIGDIVYSGVMGA
VSVILVAFSIQDLARGEGDKTLHIPALVVVGIAFVTKFALFCWCHPLRNKNSQVRVLWED
HRNDLFINGFGLFTSAAGAKIVWWLDPTGALVISFVLIATWGSTCATHFGYLAGKAAPLD
FQNLITYKAMTFAEQIEQIDSCIVYHNGPRYVVEVDLVMKGETTLRVAHDVSQALQDKLE
ELPQVDRAFVHVDHETSHKPEHRKTK