Protein Info for mRNA_2735 in Rhodosporidium toruloides IFO0880

Name: 11103
Annotation: K02257 COX10 protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 281 to 303 (23 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 476 to 495 (20 residues), see Phobius details amino acids 507 to 525 (19 residues), see Phobius details PF01040: UbiA" amino acids 269 to 512 (244 residues), 186.8 bits, see alignment E=2.3e-59 TIGR01473: protoheme IX farnesyltransferase" amino acids 271 to 524 (254 residues), 238.1 bits, see alignment E=8.3e-75

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>mRNA_2735 K02257 COX10 protoheme IX farnesyltransferase (Rhodosporidium toruloides IFO0880)
MLSRLAARQQCALCVAAAPSTALRTLPIIATSFARTRQQDTLATAWKGKGRAYGTVALAN
GTAGRAGAGLAGPTRWTRGSLAGGLAGGRTGLWDARRWASSQAKQTDAASGASPVYAHED
LLLPSSTGRRIHSRPASPARHRDPKAFFSPSYLVAEEPPLPPPSTSPLVPLSTPIPAALP
PTVLSNGLPNPDIRWRAPPQTTIRDDIQLYKALGKFKLSSLVVLTTMAGYAMCPVDPSTT
AAAMDAFAQSLGSSIPSDTSLLPAATNTLGASPANNLTLSVLLPTTVGTTLCAFSAAAFN
QLIEAPYDAQMARTRNRPLPKRTVTPLHAATYGALTGSVGLATLYAMNPLSAFLGLFTIV
LYCPLYTISKRHSVYNTWIGSVVGAIPPLIGWAACTASVDPISQPGAWALFGLMFAWQFP
HFMSLAHTLRSSYASSGYRMLAVLDPPKNALVSLRYSLALIPLCAAFPYLGLTNAAFAYL
SLLPNGLLAVAAWRFWKKREERRAKELFWASLVQLPVILALAMACKKGLWGEDENDEEV