Protein Info for mRNA_2739 in Rhodosporidium toruloides IFO0880

Name: 11107
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 81 to 103 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 298 to 324 (27 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 417 to 441 (25 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 479 to 502 (24 residues), see Phobius details PF07690: MFS_1" amino acids 88 to 469 (382 residues), 109.7 bits, see alignment E=7.7e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>mRNA_2739 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MATLQDGTPALPSSPTLSGENPDLALDADLEKQLEGSVEQSSTHGGVASTDGVVKGGELV
NGRLPHDDPLNPASWPTGKKIIVDIVLCVWVLSLTYASTAYVASLPALMKRFDVSQELAI
AGVTFTVLGFAAGPLLCAPSSELYGRRAVYIVCGVFYIAFSWGAAFANNIGALLVFRFFI
GFFGSASINNVPASVGDFTVPRTRGPFTVLYAVCAFGGPSIGPLLSAFIEHDAGFRWNLR
VMAIFSTVTSILVAFVPETHHPTLHRWRLAKEAAVEVKPGGWQVIFGVYKQALARPFVFL
FTEPVVLFVSVYLSVLYGVLYGFFEAFTVVWLEKRHFSITSYGLTYISLGLGFLVGAVGL
ILVSTRAYTKALTAAQARGQTAIPAEARLTLGYPGAIIVPLSLFLFAFTAPYPHVHWIVP
CIAEFFFGLGVLLVFTAFIPYLTDVYQTHAASALAAGMASRALVGSVFPLFSLQLYHAAT
VQGATCLFAGIACLLAPIPFVFKRKGPELRRRSMFAA