Protein Info for mRNA_2761 in Rhodosporidium toruloides IFO0880

Name: 11129
Annotation: K00031 IDH1, IDH2, icd isocitrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00127: isocitrate dehydrogenase, NADP-dependent
  • amino acids 7 to 414 (408 residues), 732.5 bits, E=5.1e-225
• PF00180: Iso_dh
  • amino acids 10 to 404 (395 residues), 234.8 bits, E=8.5e-74

Best Hits

Swiss-Prot: 69% identical to IDH1_CANTR: Isocitrate dehydrogenase [NADP], mitochondrial (IDP1) from Candida tropicalis

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 72% identity to cci:CC1G_11465)

MetaCyc: 67% identical to NADP-dependent isocitrate dehydrogenase (Saccharomyces cerevisiae)
Isocitrate dehydrogenase (NADP(+)). [EC: 1.1.1.42]

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• reductive TCA cycle I (7/11 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• mixed acid fermentation (9/16 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glutathione metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.42

Protein Sequence (421 amino acids)

>mRNA_2761 K00031 IDH1, IDH2, icd isocitrate dehydrogenase (Rhodosporidium toruloides IFO0880)
MAISPEQRIKVQNPIVEMDGDEMTRIIWHKIKKDLILPFLDVDIKYYDLGLEYRDQTDDQ
VTVDAAEAILKYGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIIVQ
KVPKAVPGWTKPIIVGRHAFGDQYRSTDIVVPEAGKLELVYTPDDKSKQPTNLEVFHFKG
PGVGLAMYNTKQSITDFAQSSFKLAIEKKLPLYMSTKNTILKGYDGQWKDIFQEIYDTQY
KAKFEELGIWYEHRLIDDMVAQMIKSSGGYIMALKNYDGDVQSDVVAQGFGSLGLMSSEL
VTPDGKIIESEAAHGTVTRHYREHQKGNETSTNSIASIYAWTRGLKFAGKRDGNERLVQF
ANDMEQACVDAVDIDGVMTKDLALSIHGKNMKREHYVLTLEYLDHIAAKVTEKFLANAPK
L