Protein Info for mRNA_2768 in Rhodosporidium toruloides IFO0880

Name: 11136
Annotation: K08681 pdxT, pdx2 5'-phosphate synthase pdxT subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03800: pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2" amino acids 10 to 161 (152 residues), 130 bits, see alignment E=5e-42 PF01174: SNO" amino acids 12 to 162 (151 residues), 137.7 bits, see alignment E=4.4e-44 amino acids 202 to 237 (36 residues), 26.3 bits, see alignment 6.4e-10 PF07685: GATase_3" amino acids 30 to 129 (100 residues), 37 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: K08681, glutamine amidotransferase [EC: 2.6.-.-] (inferred from 42% identity to fgr:FG05036.1)

Predicted SEED Role

"Pyridoxine biosynthesis glutamine amidotransferase, glutaminase subunit (EC 2.4.2.-)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 2.6.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>mRNA_2768 K08681 pdxT, pdx2 5'-phosphate synthase pdxT subunit (Rhodosporidium toruloides IFO0880)
MSPAPAPNAIGVLALQGSFAEHIHALEHIQPPQRVVAVRTPHDLEQCRALIIPGGESTTI
SLLIRKSGLYEPLKEFIARAKEDKGRSVWGTCAGMILLAREIDGPTSEGWEGFDAMDVKV
ARNQYGRQLQSFSYSVSLPFISSPSVPVLATFIRAPVLHSLLPSSPSSPPIEPLARIPPS
LIPSPPRAKSVTGGSTTLGPHADVVMYRQGGLLASSWHPELNKEDGRVHEWWVREMVLKG
EEA