Protein Info for mRNA_2769 in Rhodosporidium toruloides IFO0880

Name: 11137
Annotation: K06215 pdxS, pdx1 pyridoxal 5'-phosphate synthase pdxS subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01680: SOR_SNZ
  • amino acids 24 to 229 (206 residues), 358.6 bits, E=1.7e-111
• TIGR00343: pyridoxal 5'-phosphate synthase, synthase subunit Pdx1
  • amino acids 26 to 294 (269 residues), 460.5 bits, E=1.2e-142
• PF05690: ThiG
  • amino acids 218 to 272 (55 residues), 28.9 bits, E=1.1e-10

Best Hits

Swiss-Prot: 73% identical to PDX1_CERNC: Pyridoxal 5'-phosphate synthase subunit PDX1 (PDX1) from Cercospora nicotianae

KEGG orthology group: K06215, pyridoxine biosynthesis protein [EC: 4.-.-.-] (inferred from 73% identity to ssl:SS1G_00307)

MetaCyc: 70% identical to pyridoxal 5'-phosphate synthase (Arabidopsis thaliana col)
RXN-11322 [EC: 4.3.3.6]

Predicted SEED Role

"Pyridoxine biosynthesis glutamine amidotransferase, synthase subunit (EC 2.4.2.-)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of L-citrulline metabolism (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• pyridoxal 5'-phosphate biosynthesis II (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Biosynthesis of type II polyketide backbone
• Photosynthesis - antenna proteins
• Porphyrin and chlorophyll metabolism
• Purine metabolism
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.-.-.- or 4.3.3.6

Protein Sequence (312 amino acids)

>mRNA_2769 K06215 pdxS, pdx1 pyridoxal 5'-phosphate synthase pdxS subunit (Rhodosporidium toruloides IFO0880)
MAANGSATAPAANGHSNGAARPTFAVKAGLAQMLKGGVIMDVVNVEQAKIAEAAGACAVM
ALQRIPSDIRKDGGVARMSDPKMIKEIMEAVSIPVMAKSRIGHIVEAEILQAIGVDYIDE
SEVLTPADPSLHVDKHAFDVPFVCGCKDLGEALRRISEGAAMIRTKGEAGTGNVIEAVRH
ARKVNQQIALASTLSEIELYNMAKEISAPADLLRETAKSGRLPVVMFSAGGIATPADAAL
MMKLGMDGVFVGSGIFKSSNPSALARAIVLATTHFNDPFKLAEVSEGLGEGMKGEGKLGR
EKGEEMTADRGY