Protein Info for mRNA_2770 in Rhodosporidium toruloides IFO0880
Name: 11138
Annotation: KOG0400 40S ribosomal protein S13
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Predicted SEED Role
"SSU ribosomal protein S13e (S15p)" in subsystem Ribosome SSU eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (90 amino acids)
>mRNA_2770 KOG0400 40S ribosomal protein S13 (Rhodosporidium toruloides IFO0880) MVRRLVGHKILRVLKSNGLAPQIPEDLYCLIKKAVQVRKHLERNRNDKDSKFRLILIESR IHRLARYYRTKGQLAPTFKYEAASASTMIA