Protein Info for mRNA_2773 in Rhodosporidium toruloides IFO0880

Name: 11141
Annotation: K02953 RP-S13e, RPS13 small subunit ribosomal protein S13e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF08069: Ribosomal_S13_N" amino acids 1 to 60 (60 residues), 102.7 bits, see alignment E=9e-34 PF00312: Ribosomal_S15" amino acids 74 to 144 (71 residues), 53.5 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 75% identical to RS13_ICTPU: 40S ribosomal protein S13 (rps13) from Ictalurus punctatus

KEGG orthology group: K02953, small subunit ribosomal protein S13e (inferred from 75% identity to tca:656303)

Predicted SEED Role

"SSU ribosomal protein S13e (S15p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>mRNA_2773 K02953 RP-S13e, RPS13 small subunit ribosomal protein S13e (Rhodosporidium toruloides IFO0880)
MGRMHNPHKGIAGSALPYKRSAPRWLKISADEVKEHIFKLARKGLTPSQIGVVLRDSHGV
AQVKSVTGNKILRVLKSNGLAPQIPEDLYCLIKKAVQVRKHLERNRNDKDSKFRLILIES
RIHRLARYYRTKGQLAPTFKYEAASASTMIA