Protein Info for mRNA_2777 in Rhodosporidium toruloides IFO0880

Name: 11145
Annotation: K00948 PRPS, prsA ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF13793: Pribosyltran_N" amino acids 2 to 115 (114 residues), 122.7 bits, see alignment E=1.1e-39 TIGR01251: ribose-phosphate diphosphokinase" amino acids 3 to 309 (307 residues), 324.5 bits, see alignment E=2.7e-101 PF00156: Pribosyltran" amino acids 157 to 246 (90 residues), 42.4 bits, see alignment E=8.4e-15 PF14572: Pribosyl_synth" amino acids 201 to 309 (109 residues), 107.3 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 64% identical to KPR2_SCHPO: Ribose-phosphate pyrophosphokinase 2 (SPCC1620.06c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 65% identity to cci:CC1G_11297)

MetaCyc: 60% identical to Ribose-phosphate pyrophosphokinase 1 (Homo sapiens)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>mRNA_2777 K00948 PRPS, prsA ribose-phosphate pyrophosphokinase (Rhodosporidium toruloides IFO0880)
VYAGTSHPQLAQLIARRLGLPLGSSSIVTLPSGELSVTFHESVREADVYIVATAGGMETS
SNTALMELCIMAHTLRIASARRITAVLPHFPYARQDKKDKSRAPITAKLIANMLVEGAGI
DHVITMDLHASQIQGFFDIPLYAEPTMLQYLRDTMGKEVQNSVIVSPDAGGAKRASSMAA
ALDLDFALFHKERKKANEIARMVLVGNVQDKTAILIDDMADTCGTLALAAKHLLSNGAKR
VVALVTHGILSGPALKVLNESPLEKLIVSNSIPQEEHKRGCPKLRVIDISHVLAEAVRRS
HHGESVSQVRTITRLGRVMDYAVGLNTLADVVR