Protein Info for mRNA_2779 in Rhodosporidium toruloides IFO0880

Name: 11147
Annotation: K18278 THI5 pyrimidine precursor biosynthesis enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09084: NMT1
  • amino acids 1 to 189 (189 residues), 136.6 bits, E=6.3e-44

Best Hits

Swiss-Prot: 52% identical to NMT1_ASPPA: 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase (nmt1) from Aspergillus parasiticus

KEGG orthology group: None (inferred from 52% identity to fgr:FG01672.1)

MetaCyc: 49% identical to 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase (Saccharomyces cerevisiae)
RXN3O-3797

Predicted SEED Role

"Hydroxymethylpyrimidine synthesis protein THI5" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/10 steps found)

Protein Sequence (295 amino acids)

>mRNA_2779 K18278 THI5 pyrimidine precursor biosynthesis enzyme (Rhodosporidium toruloides IFO0880)
MDMGVKAMVHTIAAKANGHGVTSVGCILDEPFTGLLYLEGGVDGKGNGITNDFRSLKGKR
IGYVGYFGAVQVRELAEKYGMDPEKDFELIRVGMDVVGAILDGRIDAGVGIGAVNGIELE
AWCTANGRPETDVKLIRIDELAELGCCCFCSILVLANDDFRAKNPEKVAAVMRAIKRGAD
DVFAEPKKAWGDVCKFKKTFRTELFAKIYERCFPFMSRDLRNVKRDWTKVSAYCHRIGVC
DANFTPNYTNEFIQWEQLPEPADPAANQVLMAKKQDEVRVKGGVLTAAQPVAVAA