Protein Info for mRNA_2792 in Rhodosporidium toruloides IFO0880

Name: 11160
Annotation: KOG1502 Flavonol reductase/cinnamoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 86 to 105 (20 residues), see Phobius details PF01370: Epimerase" amino acids 87 to 281 (195 residues), 42.3 bits, see alignment E=1.9e-14 PF05368: NmrA" amino acids 87 to 202 (116 residues), 22.5 bits, see alignment E=2.3e-08 PF01073: 3Beta_HSD" amino acids 88 to 288 (201 residues), 55.5 bits, see alignment E=1.4e-18 PF13460: NAD_binding_10" amino acids 91 to 238 (148 residues), 38.2 bits, see alignment E=4.3e-13 PF07993: NAD_binding_4" amino acids 147 to 309 (163 residues), 27.6 bits, see alignment E=4.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>mRNA_2792 KOG1502 Flavonol reductase/cinnamoyl-CoA reductase (Rhodosporidium toruloides IFO0880)
MGQRGQVTVRRGLRRRKRSSRGILRSPFDAAFTHLSPALNTSSTCPRSNSGKAHHDDIVL
LPALLSSPSSTLHILHTQQHTMSSELVLVSGASGFVGTAVTLAFLEKGFRVRGTVRSQDK
ADKWEAKHPQYKGKIEWAIVKDIAEKGAFDEAIKGVTLVAHTASPFHYDVKDNERDMLIP
ALEGTRQILRAAQKEPSVKRVVLTSSFASVLDFDKLGPETTFTEKDWNPATYDSAKKADQ
PPYIYCASKKIAEEEAWKIAKEPETKWDLCTVCPPMVLGPISQPIGALDAINTSAGAVWA
VVDAKEVPETTFPVWVDVRDIANIHVKGVTEEISKGKRYASLLPSKRSYELTSCANSYLC
IAGHYDNTQIASIARKAFPDQASRIPDAKPSEGSPHFKTDSSLVEKELGIKWIGFEQCIK
DTLSSIFEVEKELKGSK