Protein Info for mRNA_2793 in Rhodosporidium toruloides IFO0880

Name: 11161
Annotation: KOG3834 Golgi reassembly stacking protein GRASP65, contains PDZ domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF04495: GRASP55_65" amino acids 18 to 104 (87 residues), 61.1 bits, see alignment E=2.2e-20 amino acids 112 to 226 (115 residues), 155.7 bits, see alignment E=1.4e-49 PF13180: PDZ_2" amino acids 23 to 87 (65 residues), 27.1 bits, see alignment E=6.5e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>mRNA_2793 KOG3834 Golgi reassembly stacking protein GRASP65, contains PDZ domain (Rhodosporidium toruloides IFO0880)
MGQAESHPSGGDTSASTSTANAAFHVLRVAENSPAAEAGIEPCFDFVVGAGGKQLGDEID
LLTDVLEANEGRQVSLQVYSTKRKEVREVRVVPSRTWSSAAVPGGETGAVDGQPSLLGLS
LRLCDPQHALEQVWHVLEILQGSPAQSAGLVPYGDWIVGYAGGVLRGEGDFYDIVESHVD
KPLRLFVYNSDYDVLREVILVPNRSWGGDGLLGCGVGYGLLHRIPKPQDRARQAPPPAAV
GQQFQPTYAPPPPPSTSSPASAQNRQADRLTSFLNQSGVPPAQNPLYAPPPPRSSGATAT
PPRANARPQPPPIMAAPPPPRRTAALAYDDDDDDDDDEQHQNSYGGDGYGSSSRNYDSSY
GSEHPSFSRYGDDGGYGAYDASDGVEVVPVEVITEEGDEDEHEASFVSSASGRGGPAG