Protein Info for mRNA_2835 in Rhodosporidium toruloides IFO0880

Name: 11203
Annotation: K00022 HADH 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 32 to 218 (187 residues), 189.5 bits, E=5.2e-60
• PF00725: 3HCDH
  • amino acids 220 to 322 (103 residues), 106.9 bits, E=7e-35

Best Hits

Swiss-Prot: 51% identical to HCDH2_CAEEL: Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 (B0272.3) from Caenorhabditis elegans

KEGG orthology group: K00022, 3-hydroxyacyl-CoA dehydrogenase [EC: 1.1.1.35] (inferred from 57% identity to uma:UM01099.1)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" (EC 1.1.1.157, EC 1.1.1.35)

MetaCyc Pathways

• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• oleate β-oxidation (26/35 steps found)
• fatty acid salvage (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (2/5 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• fatty acid β-oxidation I (generic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (5/18 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (4/22 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (10/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Protein Sequence (324 amino acids)

>mRNA_2835 K00022 HADH 3-hydroxyacyl-CoA dehydrogenase (Rhodosporidium toruloides IFO0880)
MLLTRTLRTLPRSQTYNAIRTLSTGAPDIQRLTVFGGGLMGAGIAQVAAQAGLKVAIADL
SDQALENSRNIITKSLTRIARKKNPDDSAAQKQFVDGVFANLTTTTSAQEAIADSDLVIE
AIVENLATKQELFRRLDGMADPKTIFASNTSSLSIRKIAEVCSDDRRKRFSGVHAFNPVP
QMKLIEIISTSETQPEITEALLDLCKRMGKTPVQCADTPGFIVNRLLVPYLLEAIRMVER
GDATAADIDTAMKLGAGVPMGPLELSDFVGLDTLSHIARGWREERVQTGEIDAKQVEEIK
ILDKLVSEGKKGRKSGEGFFNYSS