Protein Info for mRNA_2838 in Rhodosporidium toruloides IFO0880

Name: 11206
Annotation: K02934 RP-L6e, RPL6 large subunit ribosomal protein L6e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF03868: Ribosomal_L6e_N" amino acids 2 to 44 (43 residues), 25.1 bits, see alignment 1.8e-09 PF01159: Ribosomal_L6e" amino acids 109 to 207 (99 residues), 105.3 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 51% identical to RL6_MESCR: 60S ribosomal protein L6 (RPL6) from Mesembryanthemum crystallinum

KEGG orthology group: K02934, large subunit ribosomal protein L6e (inferred from 50% identity to pop:POPTR_549358)

Predicted SEED Role

"LSU ribosomal protein L6e"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>mRNA_2838 K02934 RP-L6e, RPL6 large subunit ribosomal protein L6e (Rhodosporidium toruloides IFO0880)
MARNSDVAPYIGKLSRSKLFSKKGLYKRERKSAPAAQATEEQKEQGYYPADDVRKAKASR
KSVKPTKIRESITKGTVLILLAGRFRGKRVVCLGSLPSGLLLVTGPFKVNGVPLRRVNQA
YCIATSTKVDLSNFEVDAKFNDAYFSKDKKSSTKATEKEFFGENKEKKEFPADKAVLEAV
KQTPHLAQYLNATFGLSRGQFPHLIKY