Protein Info for mRNA_2860 in Rhodosporidium toruloides IFO0880

Name: 11228
Annotation: K11811 arsH arsenical resistance protein ArsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR02690: arsenical resistance protein ArsH" amino acids 26 to 236 (211 residues), 320.5 bits, see alignment E=1.9e-100 PF03358: FMN_red" amino acids 45 to 188 (144 residues), 78.5 bits, see alignment E=2.4e-26

Best Hits

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 61% identity to mgr:MGG_12264)

MetaCyc: 59% identical to ArsH (Pseudomonas putida KT2440)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>mRNA_2860 K11811 arsH arsenical resistance protein ArsH (Rhodosporidium toruloides IFO0880)
MREEEVDRRYRPFLETKNGEDEPDWIEALELDTVREMQAREKRVKVLVLYGSLRQRSFSR
LTAYEAARVLARLGADVRVFDPTGLPIKDDVSDKHEKVVELRALSDWSDAHFWCSPEQHG
TVTAVFKNQIDWIPLSVGSVRPTQGRTVAVCQVNGGSQSFNVVNLLRVLGRWMRMFAIPN
QSSIPMAWKQYTSSDRLMPSSNRDRLVDVCEELIKVTLLLRPHFELLGDRYSEREEKREH
GRLRTQAEVEAAKDTKGAQKDAN